TB-500 (Thymosin Beta-4) Testing

MW: 4963.44 g/molHalf-life: ~2–3 hours systemically; tissue half-life longer.Status: Not FDA-approved. Banned by WADA for athletic use.

Synthetic Thymosin Beta-4; involved in actin sequestration and tissue repair.

Mechanism of action

Synthetic Thymosin Beta-4. Sequesters G-actin monomers via its β-thymosin domain, regulating cytoskeletal dynamics. Promotes endothelial cell migration, angiogenesis, and stem cell recruitment to injury sites. Sold under the name 'TB-500' in research markets; the actual molecule is full-length Thymosin β-4 — or sometimes only the active LKKTETQ fragment, which is much shorter and cheaper to make.

Sequence & structure

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 residues, acetylated N-terminus)

N-terminal acetylation is required for full activity. 'TB-500' sold without N-acetyl is technically a different molecule.

Research areas

  • Tissue repair
  • Cardiac regeneration (RegeneRx Phase 2 trials)
  • Corneal wound healing
  • Hair growth

Dosing in the literature

Veterinary use in racehorses is well-established at ~2 mg twice weekly. No FDA-approved human indication.

For research/informational purposes only — not medical advice.

What we test on TB-500 (Thymosin Beta-4)

Intact-mass LC-MS is the make-or-break test. RP-HPLC purity, N-acetyl confirmation by MS/MS, endotoxin for injectable lots.

Standard Healing & Repair Panel
  • RP-HPLC purity
  • MS/MS sequence confirmation
  • ICP-MS (Cu for GHK-Cu)
  • Endotoxin (LAL)

Common impurities & failure modes

  • Active fragment substitution

    The most common counterfeit: vendors ship the 7-residue LKKTETQ active fragment labeled as full-length TB-500. Intact mass immediately catches this (fragment is ~860 Da, full-length is ~4960 Da).

  • Missing N-acetyl group

    −42 Da shift; reduces activity.

  • Truncation at Met residue

    Methionine cleavage during synthesis.

  • Oxidation of Met6

    +16 Da shift.

Regulatory status

Not FDA-approved. Banned by WADA for athletic use.

Frequently asked questions

Is 'TB-500' the same as Thymosin Beta-4?+

Marketed as such, but check the molecular weight. Full-length is ~4963 Da. If your vial mass-specs at ~860 Da, you have the active fragment, not TB-500.

Related Healing & Repair peptides